PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24130.7 Da    PI: 9.5311
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013229.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.59.5e-301059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rien+  rqvtfskRrng+lKKA+ELSvLCdaeva+i+fss+g+lye+++
  Aco013229.1 10 RIENTASRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSSRGHLYEFAT 59
                 8***********************************************86 PP

2K-box83.16e-2879171698
        K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  +k+++ +  ++++ e a+L ++ie L+  +R+l+Ge++e++s +eL++Le qLeksl+++R++K+++ll++i+el+++e+++ +en  Lr+k 
  Aco013229.1  79 TKRAAVESIQHWKSETARLANKIEVLEAHKRKLMGEGIEPCSTEELRELEAQLEKSLSNVRATKQKMLLDHISELKEQERMALRENAVLREKC 171
                  455677789*********************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.539161IPR002100Transcription factor, MADS-box
CDDcd002654.55E-40270No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-31379IPR002100Transcription factor, MADS-box
PfamPF003194.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-293859IPR002100Transcription factor, MADS-box
PfamPF014863.1E-2686172IPR002487Transcription factor, K-box
PROSITE profilePS5129713.70587179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MARGKREMRR IENTASRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSS RGHLYEFATS  60
SVQKTIDRYK MHMKEPGSTK RAAVESIQHW KSETARLANK IEVLEAHKRK LMGEGIEPCS  120
TEELRELEAQ LEKSLSNVRA TKQKMLLDHI SELKEQERMA LRENAVLREK CKVEPLLQLT  180
IPEGINTSDQ ASPNVEVETE LIIGRPGTSD SR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-18272171Myocyte-specific enhancer factor 2A
3mu6_C9e-18272171Myocyte-specific enhancer factor 2A
3mu6_B9e-18272171Myocyte-specific enhancer factor 2A
3mu6_A9e-18272171Myocyte-specific enhancer factor 2A
1tqe_S1e-17169169Myocyte-specific enhancer factor 2B
1tqe_R1e-17169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-17169169Myocyte-specific enhancer factor 2B
1tqe_P1e-17169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384267.18e-79PREDICTED: MADS-box transcription factor 50-like isoform X1
RefseqXP_009384275.18e-79PREDICTED: MADS-box transcription factor 50-like isoform X1
SwissprotQ9XJ603e-70MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0S5259e-79M0S525_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P04340_0013e-78(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.12e-66AGAMOUS-like 19